PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G014250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family NF-YB
Protein Properties Length: 195aa    MW: 21770.3 Da    PI: 6.6446
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G014250.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB157.62e-49599397
                 NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                          +qdr+lPianv+rimk++lPa akisk+ k+t+qec++efisfvt+easdkc++e+rkt+ngdd++wal+ lGf++y+e +  yl+k+re+
  HL.SW.v1.0.G014250.1  5 DQDRMLPIANVGRIMKQILPATAKISKEGKQTMQECATEFISFVTGEASDKCHKENRKTVNGDDICWALTALGFDNYAEVIVRYLHKFREA 95
                          79***************************************************************************************** PP

                 NF-YB 94 egek 97
                          e++k
  HL.SW.v1.0.G014250.1 96 ERDK 99
                          **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.4E-475118IPR009072Histone-fold
SuperFamilySSF471137.42E-376112IPR009072Histone-fold
PfamPF008085.5E-25973IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.8E-173755No hitNo description
PROSITE patternPS0068504056IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.8E-175674No hitNo description
PRINTSPR006152.8E-177593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MVDPDQDRML PIANVGRIMK QILPATAKIS KEGKQTMQEC ATEFISFVTG EASDKCHKEN  60
RKTVNGDDIC WALTALGFDN YAEVIVRYLH KFREAERDKA NQITSTNNNP TTTTSPSHHP  120
SLPTTTTSTA TTTTYHADQD KDHHHHHLHV LSKNTCGTTT TTSTPLTLME FKIIEKGSDQ  180
YNSLMMRPHL DEAE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-40594392Transcription factor HapC (Eurofung)
4g92_B1e-40594392Transcription factor HapC (Eurofung)
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088954.18e-70Nuclear transcription factor Y subunit B-4
TrEMBLW9QH198e-70W9QH19_9R
STRINGVIT_14s0060g02660.t011e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.12e-54nuclear factor Y, subunit B4